PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc02789.1.g00080.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family MYB
Protein Properties Length: 295aa    MW: 32857.8 Da    PI: 8.294
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc02789.1.g00080.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding48.81.6e-1570117148
                                   TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
               Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                                   +g W++eEde+l+  ++++G  +W++I++  g+ R++k+c++rw++yl
  Zmw_sc02789.1.g00080.1.am.mk  70 KGLWSPEEDERLASHIARFGVSCWSSIPELTGLQRCGKSCRLRWLNYL 117
                                   678*******************************************97 PP

2Myb_DNA-binding47.93.1e-15123165145
                                   TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
               Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                                   rgr++++E++l++ ++k lG+  W+ Ia++++ gR+++++k++w+
  Zmw_sc02789.1.g00080.1.am.mk 123 RGRFSQQEEDLIIALHKTLGNS-WSQIAARLP-GRSDNEIKNFWN 165
                                   89******************99.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.5E-2262120IPR009057Homeodomain-like
PROSITE profilePS5129415.79765117IPR017930Myb domain
SuperFamilySSF466893.15E-2768164IPR009057Homeodomain-like
SMARTSM007173.4E-1169119IPR001005SANT/Myb domain
PfamPF002492.3E-1470117IPR001005SANT/Myb domain
CDDcd001671.77E-973117No hitNo description
PROSITE profilePS5129423.981118172IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.2E-25121172IPR009057Homeodomain-like
SMARTSM007174.3E-15122170IPR001005SANT/Myb domain
PfamPF002499.5E-14123165IPR001005SANT/Myb domain
CDDcd001676.79E-10125165No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 295 aa     Download sequence    Send to blast
MSGSFDPSNR RLSKMDGLKL IKHDYWMEGT RLETTYRSMA AFAMGASTAA RAFQMGRVHP  60
CCSPEKKLRK GLWSPEEDER LASHIARFGV SCWSSIPELT GLQRCGKSCR LRWLNYLRPD  120
LKRGRFSQQE EDLIIALHKT LGNSWSQIAA RLPGRSDNEI KNFWNARLRK KLRKKEASSK  180
DHVASRSRNH REDERKEPPP AMFNPLLPRD EDHITCSGAA TSSCDDSSAA GSAAAAELQM  240
PSAASSASAS TEAAGDSHDD FLRAMVEDAS YLFGDFYLDG SQDGLSSFWD GHAFS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C5e-285717216128MYB TRANSFORMING PROTEIN
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1166172RLRKKLR
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004968333.11e-110PREDICTED: transcription factor MYB82-like
TrEMBLK3XKX71e-110K3XKX7_SETIT; Uncharacterized protein
STRINGSi002550m1e-109(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP144481725